Sadyapachadi

Sadyapachadi смотреть последние обновления за сегодня на .

ഓണം സ്പെഷ്യൽ വെള്ളരിക്ക പച്ചടി || Vellarikka Pachadi ||Sadya Pachadi|| Ep:629

1286464
12920
844
00:07:51
08.09.2019

Authentic Kerala Dishes with my personal Touch 😍 🤍 - ONAM RECIPES PLAYLIST Ingredients Vellarikka -1/2 GREEN CHILLI-2 CUMIN SEEDS-ONE PINCH MUSTARD SEEDS-1 PINCH SALT WATER -1/4 +1/4CUP GRATED COCONUT-3TBSP cURD-7TBSP OIL-2TBSP CURRYLEAVES DRY RED CHILLI-2

വെള്ളരിക്ക കിച്ചടി | Vellarikka Kichadi - Malayalam Recipe | Kerala Onam Sadhya side dish

1905379
34528
1991
00:04:27
05.06.2020

Vellarikka Kichadi is a curd based vegetarian dish usually served as a side dish for Kerala feast called Sadhya - especially for Onam Sadhya. It is healthy and easy to prepare. You may get confused about the difference between Pachadi and Kichadi. The main difference is that Pachadi can be sweet but Kichadi is not sweet and also we add crushed Mustard seeds into it. Friends, try this easy cook recipe and let me know your feedback in comment section bellow. #StayHome and Celebrate Onam #WithMe #Onam — INGREDIENTS — Yellow Cucumber (വെള്ളരിയ്ക്ക) Chopped - 2 Cups (250gm) - After Cleaning Salt (ഉപ്പ്) - 1 Teaspoon Water (വെള്ളം) - ¼ Cup ————————— Grated Coconut (തേങ്ങ ചിരണ്ടിയത്) - 1 Cup Curd (തൈര്) - ½ Cup Green Chilli (പച്ചമുളക്) - 2 to 3 Nos ————————— Mustard Seeds (കടുക്) - ¼ Teaspoon Curd (തൈര്) - ½ Cup Salt (ഉപ്പ്) - ½ Teaspoon ————————— Coconut Oil (വെളിച്ചെണ്ണ) - 3 Tablespoons Mustard Seeds (കടുക്) - ½ Teaspoon Dry Red Chilli (ഉണക്കമുളക്) - 3 to 4 Nos Curry Leaves (കറിവേപ്പില) - 1 Sprig INSTAGRAM: 🤍 FACEBOOK: 🤍 Website: 🤍 ഈ യൂട്യൂബ് ചാനലിൽ നോക്കി നിങ്ങൾ തയാറാക്കിയ ഭക്ഷണത്തിന്റെ ഫോട്ടോകൾ പങ്കുവെക്കുവാനായി ഒരു ഫേസ്ബുക് ഗ്രൂപ്പ് ഉള്ള കാര്യം എല്ലാ സുഹൃത്തുക്കളുടെയും ശ്രദ്ധയിൽപ്പെടുത്തുന്നു. ഗ്രൂപ്പിന്റെ പേര് "Shaan Geo Foodies Family" എന്നാണ്. എല്ലാവരെയും സ്നേഹത്തോടെ ഗ്രൂപ്പിലേക്ക് സ്വാഗതം ചെയ്യുന്നു.

ഒഴിവാക്കാനാവില്ല ഈ ബീറ്റ്റൂട്ട് പച്ചടി😋😋| Kerala Sadya Special Beetroot Pachadi | Onam Sadya Recipes

2751738
49253
1596
00:08:07
15.08.2020

Happy Cooking with Shamees Kitchen Onam Sadya Recipes : 🤍 My Instagram: 🤍 Facebook : 🤍 Beetroot Pachadi/Kerala Sadya Special Ingredients : Beetroot 2 nos Salt as needed Water Grated Coconut 1/2 cup Cumin Seeds 1/2 tsp Ginger Green Chilli Curry leaves Curd 1 cup Coconut Oil 2-3 tbsp Mustard Seeds 1/2 tsp Red Chilli Curry leaves You can mail me at : Shameeskitchen🤍gmail.com About : Shamees Kitchen is a YouTube Channel, Where you will find Delicious Recipes with the ingredients which are easily available. Learn Interesting Recipes and Share your Feedback with us. If I can cook you can too :D Yours Cooking Channel :) *Disclaimer : All the content published on this channel is protected under the copyright law and should not be used/reproduced in full or part without the creator's prior Permission*

ഓണം സ്പെഷ്യൽ നിമിഷനേരകൊണ്ട് 3 തരംകിടു സദ്യ പച്ചടി ഒറ്റയടിക്ക്🤩 Onam Sadya Pachadi Recipe malayalam

74000
1106
46
00:06:20
11.04.2022

3 types of sadya pachadi | Kerala style pachadi recipe | 3 Kerala pachadi recipe | Beetroot pachadi | Cucumber Pachadi | Pazham pachadi | vishu special | പച്ചടി | സദ്യ കറികൾ| pachadi recipe in malayalam | Kerala style pachadi recipe for sadya | vellarikka pachadi | ethappazham pachadi | beetroot pachadi | pazham pachadi | vellarikka kichadi | 3 pachadikal | sadya recipes | വിഷു | how to make pachadi for sadya | ratio of coconut and curd for pachadi | three colorful pachadi recipes | yellow pachadi | pink pachadi | white pachadi Best of Sadya Recipes: 👇 🤍 Aviyal recipe 👇 🤍 Madura Pachadi Recipe 👇 🤍 Ingredients for 3 types of Pachadi Cucumber Pachadi cucumber - 1 bowl green chilli curryleaves salt Beetroot pachadi beetroot - 1 bowl green chilli curryleaves sugar salt - Nendrapazham pachadi Plantain / Kerala Banana - 1 + 1/2 bowl chilli powder turmeric powder green chilli curryleaves salt - Common Ingredients to be added later grated coconut cumin seeds mustard - curd oil mustard dry ed chilli curryleaves #beetrootpachadi #cucumberpachadi #onamrecipe #pazhampachadi #pachadi #keralasadyarecipes #instagram #sadya #kichadi #vellarikkapachadi #cucumberpachadi #bananapachadi #plantainrecipes #vishurecipes Sadya style pachadi recipe kerala style | onam special sweet pachadi recipe in malayalam | Onam sadya recipes | easy pachadi | pachadi on different colors | vellarikka and beetroot pachadi | easy pachadi for sadya | tasty beetroot pachadi | best പച്ചടി | with mustard | coconut and curd side dish for sadya | original sadya pachadi recipe | kalyana pachadi recipe | vishu pacadi recipe | cucumber pachadi | vellarikka pachadi recipe | malayalm pachadi vellarika recipe | velarika recipe | how to make pachadi sadya style | vegetables in pachadi | fruit pachadi for sadya | onam pachadi | onam sadya special pachadi | chinnus cherrypicks pachadi | chinnus cherry picks sadya recipe | sadhya beetroot pachadi | kalyana pachadi | kerala style curry| sadya curries| easy kerala sadhya side dishes | best kerala sadhya dish | quick kerala sadhya side dish | sadya recipes | kerala curries for rice | vishu sadya side dish kerala vishu recipes | authentic kerala sadya recipes | easy sadhya recipes | quick pachadis recipes | kerala style pachadi | easy recipes for vishu sadya| south indian feast recipes | malayalam | recipes in malayalam | kerala food tips and tricks | tasty kerala recipes |kerala veg recipes | malayalam veg recipes | naadan | naadan veg recipes | thani naadan vibavangal | best easy recipes channel| best kerala recipes | how to make recipes|thani naadan vibavangal|best kerala recipes | best recipes in malayalam | easy food ideas malayalam| instant recipe ideas thani naadan vibavangal | best easy sadya channel| best kerala recipes | how to make recipes |south Indian recipes with English subtitles | malayalam naadan food | veg recipes of kerala

പൈനാപ്പിൾ പച്ചടി | Pineapple Pachadi Kerala Style | Kerala Sadya Pachadi | Kichadi | Pachadi Recipe

1194
29
22
00:03:45
19.03.2022

Pineapple Pachadi is a special dish mainly prepared during Onam and Vishu sadhya. This pachadi is prepared using Pineapple & fine paste of coconut which gives a super tasty to kerala meals. Please try this recipe and post your feedback in the comments section. 🍯INGREDIENTS: Chopped Pineapple(പൈനാപ്പിൾ) - 300 gm Sugar (പഞ്ചസാര) - 2 Tablespoon Grated Coconut (തേങ്ങ ചിരണ്ടിയത്) - 8 Tablespoon Turmeric Powder (മഞ്ഞള്‍പൊടി) - 1/4 Teaspoon Kashmiri Chilli Powder (കാശ്മീരി മുളകുപൊടി) - 1/4 Teaspoon Coconut Oil (വെളിച്ചെണ്ണ) - 1 Tablespoon Mustard Seeds (കടുക്) - 1/2 Teaspoon (Seasoning) + 1/4 Teaspoon (grinding) Dry Red Chilli (ഉണക്കമുളക്) - 2 Nos Curry Leaves (കറിവേപ്പില) - 1 Sprig Salt (ഉപ്പ്) - Add sufficient quantity Water (വെള്ളം) - ¾ Cup ➤ SUBSCRIBE HERE: 🤍 Please keep watching and share your valuable feedback with us. You can email me at : diyarsyam🤍gmail.com

Onam Series 2: How To Make Cucumber Kichadi || Betroot Kichadi || Pineapple Pachadi || Lekshmi Nair

2519686
30030
2178
00:25:02
23.08.2019

Hello dear friends, this is my Thirty- Eighth Vlog and my second Onam Series Episode. In this video, I have demonstrated the simplest method to make Sadhya Style Cucumber (Vellarikka) Kichadi, Betroot Kichadi And Pineapple Pachadi . SO, watch this video till the end and please comment your valuable feedbacks. NOTE: ©This Recipe is developed and first published by LEKSHMI NAIR (Celibrity Culinary Expert) Hope you will all enjoy this video. Don't forget to Like, Share and Subscribe. Love you all :) :) For Business Enquiries, Contact: Phone: +91 7994378438 Email: contact🤍lekshminair.com Some Related Videos For You:- Onam Series 1 - How To Make Sadya Pickles || ഇഞ്ചിക്കറി, നാരങ്ങാ കറി & മാങ്ങ കറി || Lekshmi Nair 🤍 Instagram Link :- 🤍 Official Facebook Page :- 🤍 Facebook Profile :- 🤍 Facebook Page (For Catering) :- 🤍 Ingredients: SADHYA STYLE CUCUMBER (VELLARIKKA) KICHADI:- Cucumber (Vellarikka)- 1 Cup (Finely Chopped) Salt- According To Taste Coconut (Grated)- 1 Cup Green Chillies- 2 Big Coriander Leaves (Chopped)- 1 Tbs Curd- 1 1/2 Cup SADHYA STYLE BETROOT KICHADI:- Betroot- 1 Nos. Green Chillies- 3 Nos. Coconut (Grated)- 1Cup Curd- 1 1/2 Cup Coriander Leaves (Chopped)- 1 Tbs SADHYA STYLE PINEAPPLE PACHADI:- Pineapple (Chopped)- 1 Cup Water- 1 Cup Tumeric Powder- 1/4th to 1/2 Tsp Coconut (Grated)- 3/4th Cup Green Chillies- 3 Nos Jeera- 3/4th Tsp Sugar- 1/2 Cup Salt- According To Taste For Tempering (Cucumber Kichadi, Betroot Kichadi and Pineapple Pachadi):- Coconut Oil- 4 Tbs Mustard Seeds- 3 Tsp Dry Red Chillies- 8 Nos. Curry Leaves Preparation:- Please follow the instructions as shown in the video. Happy Cooking :)

Kumbalanga Pachadi / സദ്യയിലെ കുമ്പളങ്ങ പച്ചടി / Kerala Pachadi

35552
418
40
00:05:23
10.08.2021

Learn how to make kumbalanga pachadi / ashgourd pachadi in easy steps Kumbalanga pachadi is a sadya pachadi done with ashgourd, curd, and coconut as main ingredients. Thickness of pachadi comes from curd and coconut, which is the base of ashgourd pachadi. Ingredients Ash gourd/ Kumbalanga - 2 cups Water - 1/4 cup Salt Grated Coconut - 3/4 cup Green chilli - 3 nos Mustard seeds - 1/2 tsp For tempering Coconut Oil - 2 tsp Mustard seeds - 1/2 tsp Dry red chillies - 3 nos Green chillies - 2 -3 nos Curry leaves Kumbalanga vanpayar olan - 🤍 Kumbalanga moru curry - 🤍 Kumbalanga Mulakushyam - 🤍 Pineapple pulissery - 🤍 Sharkaravaratti - 🤍 Kaya nurukku upperi - 🤍 Kerala banana chips - 🤍 Bun Dosa & Tomato Onion Chutney - 🤍 * #kumbalangapachadi #sadyapachadi #ashgourd

Vellarikka Pachadi || Sadya Pachadi || Onam Recipe - 244

1888
666
115
00:05:41
23.08.2022

Vellarikka Pachadi ingredients vellarikka - 1/2 of 1 salt to taste water - 1 cup *for grinding grated coconut - 1 cup green chilli - 2 nos cumin seeds - 1/4 tsp mustard seeds - 1/2 tsp water as required thick curd - 3/4 cup for seasoning coconut oil mustard seeds dry red chilli curry leaves #pachadi #vellarikkapachadi #onamrecipes

Apple pachadi Kerala style recipe | Onam sadya pachadi recipe

12527
121
9
00:02:22
06.09.2019

Apple pachadi Kerala style recipe | Onam sadya pachadi recipe Happy Cooking with Jinooskitchen Email: jinooskitchen🤍gmail.com Website: 🤍 Instagram: 🤍 Facebook: 🤍 Twitter: 🤍 Pinterest: 🤍 #applepachadi #pachadi #keralasadhya

സദ്യയിലെ വെണ്ടയ്ക്ക കിച്ചടി | Sadya Vendakka Kichadi - Okra Yogurt Curry | Ladies Finger - Ep :132

541186
486
00:09:30
10.04.2017

U Can contact me here 👇 veeenajan🤍gmail.com - Mail id 🤍 - Instagram 🤍 - ഓണം വിഭവങ്ങൾ പ്ലേലിസ്റ്റ് - Onam Sadya Dishes Playlist U Can contact me here 👇 veeenajan🤍gmail.com - Mail id 🤍 - Instagram 🤍 - ഓണം വിഭവങ്ങൾ പ്ലേലിസ്റ്റ് - Onam Sadya Dishes Playlist Ladies Finger/Vendakka-15 Curd-2cup/400gm Salt- Grated coconut-1/4 of 1 Mustard seeds-1/4tsp Green chilli-2 Oil- for frying For Seasoning Dry red chilli-2 Curry leaves-1 string Mustard seeds-1/2tsp Method Thoroughly wash each ladies finger and wipe with a kitchen tissue Cut into thin medium thin slices and sprinkle very small amount of salt ..Keep aside for 10 minute .. Then heat oil and fry this ladysfinger along with one chilli(slits) till it become crisp .. (but take care not to burn ) Remove from the oil and keep in a kitchen towel to remove the excess oil.. Make fine paste of coconut ,one green chilli,and mustard seeds along with half cup or enough curd to grind .. In a wide bowl take rest of the curd and beat well with a spoon or fork.. Into that add this fine paste and mix well .Add salt and combine well.. Heat oil and splutter mustard seeds followed by red chilli slits and curry leaves .. Add this seasoning and mix ..Check the taste ,Add salt if needed.. Finally add fried ladies finger just before serving ,so that crispness will be there .. Note : If u find the curd to be too sour u can add small amount of sugar to it ..

Sadya Special Madhura Pachadi || സദ്യ മധുര പച്ചടി || Pineapple-Munthiri Pachadi||Ep:405

650930
6535
552
00:15:58
15.08.2018

If anyone want to donate to kerala chief ministers flood disaster fund plz click the link below👇👇👇👇 Plz help our Kerala 🤍 Authentic Kerala Dishes with my personal Touch 😍 Ingredients Pineapple -1 1/2cup Banana-1 small Grapes-15 Chilli Powder-1/2tsp Turmeric powder-1/4tsp Salt- Curd-8tbsp Curry leaves- Water-3/4cup Coconut Oil-3tbsp Mustard seeds-1/2tsp Dry red chilli-4 Mustard seeds-1/2 tsp(extra) Grated Coconut-3/4cup Cumin seeds-1/4tsp Green chilli-2 Sugar-2tbsp Method Cut pineapple into small pieces .. Cook pineapple along with chilli powder,turmeric powder ,salt and water in a pressure cooker for 4 whistle . Then transfer into a heavy bottomed vessel and add banana pieces . Close and cook for another 5 minutes . In between grind coconut along with cumin seeds ,green chilli and water .. When the banana is cooked add ground paste and boil. Then add crushed mustard seeds ..add sugar and mix well . Now add whipped curd and mix . Then turn off the fire .. Heat oil and splutter mustard seeds ,dry red chilli and curryleaves . Pour this to the pachadi and close the vessel . After 10 minutes mix well. Check the taste .

പൈനാപ്പിൾ പച്ചടി ||kerala sadya pachadi || pineapple madhura pachadi|| kichadi || onam sadya recipes

1249
241
83
00:04:45
06.09.2022

പൈനാപ്പിൾ പച്ചടി ||kerala sadya pachadi || pineapple madhura pachadi|| kichadi || onam sadya recipes pineapple pachadi is a traditional recipe for onam celebration *sadya special easy recipes*🍛🍲 🔰പച്ച മാങ്ങാ പച്ചടി /raw mango curry 👇 🤍 🔰നാവിൽ കപ്പലോടും അടമാങ്ങാ അച്ചാർ 🤍 🔰പച്ചക്കറികൾ ഒന്നുമില്ലാതെ അടിപൊളി കറി 🤍 🔰special ബദാം പായസം 🤍 🔰വെള്ളുത്തുള്ളി അച്ചാർ 🤍 🔰ചെറുപയർ പായസം 🤍 🔰അച്ചാർ പൊടി 🤍 🔰രസപ്പൊടി 🤍 🔰മത്തങ്ങാതോരൻ 🤍 🔰തൈരില്ലാതെ മോരുകറി 🤍 🔰വെണ്ടയ്ക്ക പച്ചടി 🤍 #onam #onamspecial #pineapple #pachadi #sadyarecipes #kerala #keralafood #traditional #kichadi #recipe #easy #madhurapachadi #happy #happyonam #onasadya traditional pachadi recipe onam recipe onam sadya recipes kerala style pachadi kerala style kichadi pineapple pachadi madhura kari madhura pachadi recipe sadya pachadi making malayalam onam happy onam

പൈനാപ്പിൾ പച്ചടി | Pineapple Madhura Pachadi | Kerala Sadya Pachadi | Kichadi | Pachadi Recipe

768512
14900
829
00:08:59
26.07.2020

Happy Cooking with Shamees Kitchen My Instagram: 🤍 Facebook : 🤍 You can mail me at : Shameeskitchen🤍gmail.com Ingredients : Pineapple 200gm Required Water Red Chilli Powder 1/2 tsp Turmeric Powder 1/4 tsp Salt as needed Grated Coconut 1 cup Mustard seeds 1/2 tsp Cumin Seeds 1/2 tsp Water 1/2 cup Curd 150ml Green Chilli 2 nos Coconut Oil 2-3 tbsp Mustard Seeds 1/2 tsp Fenugreek Seeds 1/4 tsp Red Chilli Curry Leaves About : Shamees Kitchen is a YouTube Channel, Where you will find Delicious Recipes with the ingredients which are easily available. Learn Interesting Recipes and Share your Feedback with us. If I can cook you can too :D Yours Cooking Channel :) *Disclaimer : All the content published on this channel is protected under the copyright law and should not be used/reproduced in full or part without the creator's prior Permission*

Cucumber Pachadi |കക്കരിക്ക പച്ചടി | Kerala Sadya Pachadi Recipe

1997
193
30
00:04:36
30.08.2020

#Najmazing #Cucumberpachadi #Kakkarikkapachadi #Easykeralasadyarecipe #Sadya Ingredients: Cucumber Coconut Curd Green Chilli Curry Leaves Mustard Seeds Coconut Oil Dry Chilli Salt

ഓണം സ്പെഷ്യൽ ബീറ്റ്റൂട്ട് പച്ചടി / കിച്ചടി onam special Sadya Beetroot Pachadi Kerala sadya Recipe

134250
1196
73
00:09:16
28.08.2019

#beetrootpachadi #pachadi #sadyapachadi #onamspecial #keralaonamrecipes #devipaviliononamspecial ചേരുവകൾ Beetroot, [ ബ്രീറ്റൂറ്റ് ] - 1 medium [ അത്യവിശം വലുത് ] Ginger - Small Pic [ ചെറിയ ഒരു കഷ്ണം ] Curd, [ തൈര് ] - 1 Cup 250 ml ,[ ഒരു കപ്പ് Ginger [ ഇഞ്ചി ] - small Pic [ ഒരു ചെറിയ കഷ്ണം ] Green chilli [ പച്ചമുളക് ] - CocConut grated - 1/2 cup [ അര കപ്പ് ] mustard seeds [ കടുക് ] - 1 tsp total [1tspചതയ്ക്കാൻ ] താളിക്കാൻ [Seasoning ] mustard - 1 tsp Salt - oil Dry Red chilli curry leaves ബാക്കി video yil

വെള്ളരിക്ക പച്ചടി തനി നാടൻ രീതിയിൽ | VELLARIKKA PACHADI | SADYA PACHADI

134
3
0
00:03:35
11.02.2022

സദ്യയ്ക്ക് തയ്യാറാക്കുന്ന വെള്ളരിക്ക പച്ചടി തനി നാടൻ രീതിയിൽ വീട്ടിൽ തയ്യാറാക്കാം. ഒരാഴ്ച വരെ കേട് കൂടാതെ ഉപയോഗിക്കുകയും ചെയ്യാം. cucumber pachadi recipe

beetroot pachadi | ബീറ്റ്റൂട്ട് പച്ചടി | sadya pachadi |beetroot pachadi malayalam| kitchen diaries

2027
155
101
00:04:29
12.07.2020

സദ്യ സ്പെഷ്യൽ ബീറ്റ്റൂട്ട് പച്ചടി | sadya special beetroot pachadi |beetroot pachadi | pachadi #Pachadi#beetrootpachadi#onasadya#kitchendiaries#kichadi#beetroot_pachadi_malayalam#sadya_pachadi ingredients beetroot grated coconut green chilly mustard seeds curd salt coconut oil curry leaves Created by VideoShow:🤍 #videoshow

കേരളാ സദ്യ സ്റ്റൈല്‍ തൈര് പച്ചടി/Kerala sadya style Curd Pachadi

215717
1794
250
00:09:16
08.03.2017

കേരളാ സദ്യ സ്റ്റൈല്‍ തൈര് പച്ചടി എങ്ങനെ ഉണ്ടാക്കാം എന്നാണു ഈ വീഡിയോയില്‍ പറയുന്നത്.. Kerala sadya style pachadi Authentic kerala style pachadi recipe ഇഷ്ട്ടമായെങ്കില്‍ ലൈക്‌ ചെയ്യാന്‍ മറക്കല്ലേ All Videos : Music:Youtube Audio Library Called Upon🤍

Beetroot pachadi || sadya pachadi || onam special pachadi || onam sadya beetroot pachadi | pachadi |

36
1
00:03:01
06.09.2022

Beetroot pachadi INGREDIENTS: Beetroot - 1 cup finely chopped or grated Green chilly - 1 Yogurt - 1/2 cup Coconut - 1/2 cup Water - 1/4 cup Salt - 1/2 tsp Mustard seed - 1 tsp Coconut oil - 1 tbsp Curry leaves Dried red chilly METHOD: 🥥 In a pan/kadai add in the beetroot and water and cook. 🥥 grind the coconut, yogurt and green chilly in a mixer grinder. 🥥 once the beetroot gets cooked add in the salt and grinded coconut and cook until it just starts to boil. 🥥 switch off the flame before it boils much. 🥥 heat the oil in a kadai and splutter the mustard seed, curry leaves and dried red chilly. Pour this over the cooked beetroot . 🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥🥥 • • • • • • • • • • • • • #foodrecipe #foodrecipes #foodlover #recipe #recipes #recipecreator #mealprep #recipeshare #foodie #foodies #foodiefeature #foodieforever #foodielovers #foodie #food #food #foodporn #foodilysm #foodbaby #onam #photooftheday #bestoftheday #onamsadya #onam #kerala #onamcelebration #indianfoodblogger #beetroots #beetroot #onamsadyaseries #beetrootpachadi #onamsadya #onam2022 #onam2k22 #onamsadyaseries

സദ്യ മധുരപച്ചടി | പൈനാപ്പിൾ പച്ചടി | Sadya Madhura Pachadi | Pineapple Pachadi

532961
7437
395
00:06:26
15.08.2020

#മധുരപച്ചടി Ingrediants pineapple 1 grapes 10 green chilli 5 red chilli 2 mustard seeds 2 tspn curd 4 tbspn. cocunut half shell salt curry leaves turmeric powder 1 tspn Chop the pineapple into too fine pieces..In a kadai add chopped pineapple,,turmeric powder ,water and salt .Mix well..Close the kadai and cook for about 20 minutes in low flame ..Stir occasionally.. when the pineapple is well cooked and by then no water will be there,add jaggery and mix well and cook for another 15 minutes ..No need to close the kadai . .In between make fine paste of grated coconut , by adding very little water ..When the jaggery is nicely blend with the pineapple add this fine paste and mix well ..Now u can add crushed green chillies and mustard seeds .Boil for one minute,switch off the flame and then add the grapes,curry leaves and thick curd .Check the taste After adding curd dont boil the pachadi…Now season with curry leaves,dry red chilly and mustard seeds. After seasoning mix well and close the kadai for 1/2 hour b4 serving .. U can adjust jaggery according to ur taste .Her ..banana and grapes are optional ..Pineapple itself is enough ..For a change u can add these two thats all.. Madhura Pachadi Sadya Pachadi Pineapple Pachadi

beetroot pachadi/naden pachadi/sadyapachadi/beetroot pachadi

19
9
2
00:01:00
28.09.2022

beetroot pachadi/naden pachadi/sadyapachadi/beetroot pachadi 🤍Village Cooking - Kerala 🤍Village Cooking Channel 🤍Village Food Channel

Kumbalanga Pachadi ll Sadya Pachadi ll കുമ്പളങ്ങ പച്ചടി

1135
99
21
00:03:57
14.03.2022

#pachadirecipe #kumbalangapachadi This pachadi is commonly made in vishu sadya, onam sadya and marriage sadya. There are many pachadi varieties made with different vegetables like cucumber, tomato, pineapple and beetroot. Here i will show how to make sadya special kumbalanga pachadi.

Ep:142 Onam Special Sweet Pachadi Kerala Sadya Pachadi പൈനാപ്പിൾ പച്ചടി Madhura Pachadi #onamdishes

2321
653
134
00:07:17
27.09.2022

#pachadirecipes #pineapplepachadi #sweetpachadi #onamdishes #vegan #sadya #sadyarecipes #sidedish Ingredients : Pineapple Required Water Turmeric Powder Salt as needed For Grainding Grated Coconut Mustard seeds Cumin Seeds Curd Green Chilli For Seasoning Coconut Oil Mustard Seeds Small onion Red Chilli Curry Leaves Preparation:- Pls follow the instructions as shown in the video. Follow me on Instagram: - 🤍 Follow My Facebook Page: 🤍

Vellarikka Pachadi |Sadya Pachadi|ഓണം സ്പെഷ്യൽ വെള്ളരിക്ക പച്ചടി | claypotrecipes| Howtomake pachadi

4409
304
68
00:02:39
03.07.2021

Preparation Time : 5 minutes Cooking time : 8-12 minutes Serves : 4 Ingredients : Cucumber /Vellarikka : 1medium(peel the skin and chop into small pieces) Coconut Oil : 1 tsp Salt to taste mustard -1/4 Curd : 1 cup Curry leaves: 1 sprig To grind: Green Chillies :1 Grated Coconut : 1 cup Mustard Seeds : 1/4 tsp method: 1. Cook the chopped cucumber with salt, adding little water till it turn to soft. 2. Grind the grated coconut, green chillies,and mustard 1/4 into a smooth paste with little water. 3. Add the coconut paste to the cooked cucumber and heat it over low flame till raw smell leave. then add curd mix well and switch off the flame and set it aside. 4. Heat oil for tempering in a small frying pan and add the curry leaves, mustard seeds, when the mustard seeds start popping, add it to the pachadi and mix well. 5. Serve with steamed rice and enjoy! #vellarikka pachadi #claypotrecipes

ഓണം സ്പെഷ്യൽ വെള്ളരിക്ക പച്ചടി|Vellarikka Pachadi|Sadya Pachadi|Cucumber Pachadi|Onam Series 2021

219
80
70
00:01:28
20.08.2021

Vellarikka Pachadi/വെള്ളരിക്ക പച്ചടി Oil/എണ്ണ - 1 tbsp Cucumber/വെള്ളരിക്ക - 1/2 Greenchilly/പച്ചമുളക് - 2 Salt/ഉപ്പ് (according to taste) Grated Coconut/ചിരുകിയ തേങ്ങ - 1/2 cup Garlic/വെളുത്തുള്ളി - 5 Cumin seeds/ജീരകം - 1/2 tsp Curd/തൈര് - 1 cup For Seasoning Oil/എണ്ണ - 2 tbsp Dry Red Chilli/വറ്റൽമുളക് - 3 Shallots/കൊച്ചുള്ളി - 3 Curryleaves/കറിവേപ്പില - 3 sprigs #vellarikkapachadi #sadyapachadi #onamspecialpachadi #howtomakecucumberpachadi #vellarikkapachadirecipe #vellarikkapachadirecipeinmalayalam #keralastylevellarikkapachadi #vellarikkakichadi #keralaonamsadhyasidedish #vellarikkapachadionamsadya #sadyarecipe #sidedish #sadhya #onasadya #onam #cucumberpachadi #keralasadyapachadi #vellarikkaikooturecipe #thairukichadi #cucumber #vellarikka #onamseries2021 #Coronaonam #chandanasfoodcorner #mallufoodchannel

Kerala Style Pazham Pachadi|പഴം പച്ചടി ഇങ്ങനെ തയ്യാറാക്കി നോക്കൂ|Onam Sadya Pachadi

14983
204
33
00:08:51
08.09.2019

#pachadi #kichadi #onamsadya Ingredients: Banana(Nenthrappazham)-1medium Scrapped coconut- 5 tbspn Green chilly-2 to 3 Nos Shallots-6 Mustard seeds- 1 tspn Curry leaves- 1 sprig Cumin seeds- 1/4 tspn Salt- to taste Kashmeeri chilly powder- tsp Turmeric powder- 1/4 tspn Dry red chillies- 2 Youghurt- 1 cup Coconut oil- as needed Fenugreek powder- apinch Kashmeeri chilly powder- 1/4 tspn 🤍 pachadi kerala style pachadi undakkunna vidham pachadi pachadi kerala style pachadi recipe pachadi curry pachadi malabar style pachadi without coconut pachadi with curd pachadi with coconut pazham pachadi recipe malayalam kerala style pazham pachadi recipe kerala style pazham pachadi kerala pazham pachadi recipe kerala style pazham pachadi with curd kerala style pazham pachadi with coconut kerala pazham pachadi pazham pachadirecipe pazham pachadi curry pazham pachadi in malayalam onam sadya pazham pachadi onam special pachadi kerala sadya pachadi kerala sadya pazham pachadi how to make pachadi how to make pazham pachadi

Sadya Special Vellarikka Pachadi | Cucumber Pachadi | Sadya Pachadi

177
14
12
00:04:48
28.08.2020

Sadya Special Vellarikka Pachadi | Cucumber Pachadi | Sadya Pachadi Nadan Varutharacha Sambar 🤍 Instant Sambar 🤍 Sadya Special Rasam 🤍 Sadya Special Koottu Curry 🤍 Sadya Special Kumbalanga Olan 🤍 Sadya Special Aviyal 🤍 Sadya Special Cabbage Thoran 🤍 Sadya Special Erissery 🤍 Nadan Beetroot Pachadi 🤍 Onam Special Achinga Mezhukkuvaratti 🤍 Sadya Special Kurukku Kalan 🤍 Sadhya Special Manga Achar 🤍 Sadhya Special Parippu Pradhaman 🤍 Naranga Achar 🤍 Haii Friends... Welcome to Rekha's World. Cooking is an Art. This Channel will take you to the authentic taste of Indian Traditional foods with my personal touch. Please leave your valuable comments and feedback about this recipe. If you like this dish please Share and Subscribe 😍 You can contact me here👎 Mail id: rekha.k084🤍gmail.com Facebook: 🤍 Instagram: 🤍 #vellarikkapachadi #cucumberpachadi #sadyapachadi #onamrecipe #howtomakepachadi #pachadirecipe #rekhasworld

Vellarikka Pachadi | Kerala Sadya Recipe | Kerala Sadya Pachadi/ Kichadi Recipe

22499
137
7
00:06:26
30.07.2018

#keralarecipes #sadyarecipes #anishyaskitchen recipes * Best combination * ★ Kerala Sadya Step by step instruction 🤍 ★★★ My Links ★★★ » Blog - anishyaskitchen.com » Facebook - 🤍 » Instagram - 🤍 » Twitter - 🤍 » Pinterest - 🤍 Email me 🤍 anishyaskitchen🤍gmail.com With ❤ Anishya!

ഇതാണ് സദ്യ സ്റ്റൈൽ പച്ചടി |Pineapple Pachadi Recipe | Pazhayidom Specials

222431
5347
973
00:09:33
15.06.2021

Ruchi, a Visual Travelouge by Yadu Pazhayidom Let's Chat at : 🤍 🤍 🤍 പച്ചടി (മധുരക്കറി) ഒത്തിരി subscribers നിരന്തരമായി ചോദിക്കുന്ന റെസിപ്പി ആരുന്നു പച്ചടിയുടേത്. വളരെ എളുപ്പത്തിൽ പാകം ചെയ്യാവുന്ന ഒരു വിഭവം ആണിത്. പൊതുവെ മധ്യ തിരുവതാംകൂറിൽ അച്ഛന്റെ റെസിപ്പി ആണ് സദ്യയിൽ പച്ചടി പാകം ചെയ്യുമ്പോൾ ഇപ്പോൾ ഉപയോഗിക്കുന്നത്. വീഡിയോ കണ്ട ശേഷം ഇഷ്ടപ്പെട്ടെങ്കിൽ എല്ലാവരും ഷെയർ ചെയ്യണേ...!! Detailed recipe of Pachadi will be added Soon..!!

കേരള സദ്യ പച്ചടി | Kerala Sadya Pachadi | Ethapazham Pachadi | Nenthrapazham Pachadi |Banana Pachadi

82229
1173
17
00:05:57
20.08.2020

INGREDIENT FOR SADYA PACHADI 1) Banana- 1 no. 2) Green chilli- 2no. 3) Coconut- 1/4 cup. 4) Cumin seed- 1/4 tsp. 5) Mustard- 1/2 tsp. 6) Turmeric powder- 1/4 tsp. 7) Yogurt- 1/2 cup. 8) Sugar- 1 tbsp. 9) Warm water. 10) Salt. 11) Coconut oil- 2 tbsp. 12) Dry chilli. 13) Curry leaves. Soumya Tasty Kitchen Onam Sadya Recipes Link. Sadya Parippu 🤍 Sharkara Varatti 🤍 Mango Pickle 🤍 Ginger Pickle 🤍 Cabbage Thoran 🤍 Moru Curry 🤍

Vendaykka Pachadi | Kerala Style | Super easy | Sadya Pachadi

141
26
5
00:02:03
02.08.2021

#Pachadi #Sadya #Okra Pachadi is a South Indian dish served as a side dish in sadya. It is so simple and easy to make. The main ingredient is yoghurt/curd. Here I am making pachadi using Vendaykka/Okra

Pachadi Recipe|Kerala Special Pachadi|Sadya Pachadi| Kerala Sadya Special Curry|Onasadya |Malayalam

1109
22
9
00:05:38
30.08.2022

Pachadi Recipe|Kerala Special Pachadi|Sadya Pachadi| Kerala Sadya Special Curry|Onasadya |Malayalam pachadi recipe ONAM 2022 Ulli Theeyal:-🤍 Inji Puli:-🤍 Inji Curry:-🤍 Beetroot Pachadi:-🤍 High Protein Salad :- 🤍 Milk ice:- 🤍 Idinjakka cutlet:- 🤍 No coconut chutney recipe:- 🤍 Nellikka laddu:- 🤍 Veg pizza:-🤍 Gobi manchurian:-🤍 Aval vada:- 🤍 Green chicken biryani: 🤍 FOLLOW US: INSTAGRAM: 🤍 FACEBOOK:🤍 TWITTER:🤍 DONT FORGET TO LIKE, COMMENT, SHARE AND SUBSCRIBE Please visit our Vision channel Ikku's Vision:- 🤍 Please visit our Creative Channel idea:-🤍 #pachadirecipe #pachadi #onamspecial #onasadya #pachadirecipe #pachadi #onasadhya Your Queries :- onam sadya recipe in malayalam onam sadya recipe malayalam onam sadhya recipe in malayalam onam sadya pachadi food recipes malayalam malayalam recipes kerala pachadi sadya pachadi pachadi sadya pachadi kerala pachadi recipes onam sadya pachadi lerala sadya special kerala sadya special curry pachadi curry cucumber pachadi pachadi verieties vellarikka pachadi pavakka pachadi vendakka pachadi onasadya recipes onasadhya recipes onam sadhya recipes in malayalam onasadya കറികള് l (THANKS FOR WATCHING THIS VIDEO) Ikku's Dine Team Kannur Kerala India

SADYA PACHADI / ONAM SADYA RECIPE /ONION TOMATO PACHADI /PACHADI RECIPE/ ഉള്ളിത്തക്കാളി പച്ചടി

890
32
27
00:04:37
27.04.2018

ONION TOMATO PACHADI /PACHADI RECIPE/ SADYA RECIPE.. ONAM SADYA RECIPE/ VISHU SADYA RECIPE.. SADYA RECIPE... SADYA PACHADI... VISHU SADYA... VISHU SADYA PACHADI... VISHU SADYA RECIPE... ഉള്ളിത്തക്കാളി പച്ചടി ഉണ്ടാക്കുന്നവിധം:- ഉള്ളിയും തക്കാളിയും ചെറുതായി മുറിച്ചെടുത്തു ഒരു പാത്രത്തിൽ ഇട്ട് കുറച്ച ഉപ്പുംചേർത്തനല്ലപോലെ കൈ കൊണ്ട് അമർത്തി കുഴച്ചെടുക്കുക. ഇനി ഒരുജാറിൽ ചുരണ്ടിയ തേങ്ങയും, മുളകുപൊടിയും, പുളിയുള്ള തൈരും ഇത്തിരിവെള്ളവും ചേർത്തു നന്നായി അരച്ചെടുത്, പിന്നെ ഇത്തിരി കടുകും ചേർത്തു ഒന്നുകൂടി തിരിച്ചെടുത്തു ഉള്ളിയുടെയും,തക്കാളിയുടെയും കൂടെ ഒഴിക്കുക. നല്ലപോലെ മിക്സ്ചെയ്യുക. ആവശ്യത്തിന് ഉപ്പുംപുളിയും ഉണ്ടോയെന്ന് നോക്കുക.പിന്നെ ഇതിലേക്ക് വെളിച്ചെണ്ണയിൽ കടുക്, ഉണക്ക മുളക് ,കറിവേപ്പില എന്നിവ ചേർത്തു വറുത്തിടുക. ഉള്ളിത്തക്കാളി പച്ചടി തയ്യാർ.

പൈനാപ്പിൾ പച്ചടി | Pineapple Madhura Pachadi | Kerala Sadya Pachadi | Pachadi Recipe

116
14
4
00:06:28
28.04.2022

അടിപൊളി രുചിയിൽ പൈനാപ്പിൾ പച്ചടി | Kerala Onam Sadya Special Pineapple Pachadi - Madhura Pachadi #malayalamcooking #perammascooking #pineapplepachadi

Papaya pachadi | Pachadi recipe | Omakka papparakka kappalanga recipe | Sadya pachadi Ep29

147
13
5
00:03:39
14.07.2020

Ingredients (included in the video) #howtomakepapayapachadi #onamvishupachadi #beegumscookbookpapayapachadi

🔆പൈനാപ്പിൾ പച്ചടി | Kerala Sadya Pachadi|Pineapple Madhura Pachadi |Easy Onam Recepi|Pachadi Recepi

118
3
0
00:03:25
27.01.2022

പൈനാപ്പിൾ പച്ചടി | Kerala Sadya Pachadi | Pineapple Madhura Pachadi |Easy Onam Recepi|Pachadi Recepi 🤍Hari's Kitchen 💫Like💫 💫Share💫 💫Subscribe💫 *Disclaimer : All the content published on this channel is protected under the copyright law and should not be used/reproduced in full or part without the creator's prior Permission* #Hariskitchen#hariskitchen #easyrecipe #pachadi #pinnapple#easyrecipe #howto #sadyarecipes #keralarecipes

Назад
Что ищут прямо сейчас на
sadyapachadi Jaro dharan police shroud boss IEPL zizi kirana Hardcase Binod Marandi Npm Bedah kolam Geografia วัดโฆสิตาราม movie like vocal pedal Canva premium showbiz ilmu sains HyperSpin quayumova Sound viral